Post-translational thioamidation of methyl-coenzyme M reductase, a key enzyme in methanogenic and methanotrophic Archaea
Abstract
Methyl-coenzyme M reductase (MCR), found in strictly anaerobic methanogenic and methanotrophic archaea, catalyzes the reversible production and consumption of the potent greenhouse gas methane. The α subunit of MCR (McrA) contains several unusual post-translational modifications, including a rare thioamidation of glycine. Based on the presumed function of homologous genes involved in the biosynthesis of thioviridamide, a thioamide-containing natural product, we hypothesized that the archaeal tfuA and ycaO genes would be responsible for post-translational installation of thioglycine into McrA. Mass spectrometric characterization of McrA from the methanogenic archaeon Methanosarcina acetivorans lacking tfuA and/or ycaO revealed the presence of glycine, rather than thioglycine, supporting this hypothesis. Phenotypic characterization of the ∆ycaO-tfuA mutant revealed a severe growth rate defect on substrates with low free energy yields and at elevated temperatures (39°C - 45°C). Our analyses support a role for thioglycine in stabilizing the protein secondary structure near the active site.
https://doi.org/10.7554/eLife.29218.001Introduction
Methyl-coenzyme M reductase (MCR) is a unique enzyme found exclusively in anaerobic archaea, where it catalyzes the reversible conversion of methyl-coenzyme M (CoM, 2-methylmercaptoethanesulfonate) and coenzyme B (CoB, 7-thioheptanoylthreoninephosphate) to methane and a CoB-CoM heterodisulfide (Ermler et al., 1997; Scheller et al., 2010):
This reaction, which has been proposed to proceed via an unprecedented methyl radical intermediate (Wongnate et al., 2016), plays a critical role in the global carbon cycle (Thauer et al., 2008). In the forward direction, MCR catalyzes the formation of methane in methane-producing archaea (methanogens). In the reverse direction, MCR catalyzes the consumption of methane in methanotrophic archaea (known as ANMEs, for anaerobic oxidation of methane). Together, these processes produce and consume gigatons of methane each year, helping to establish the steady-state atmospheric levels of an important greenhouse gas. MCR displays an α2β2γ2 protein domain architecture and contains two molecules of F430, a nickel porphinoid cofactor (Ermler et al., 1997; Zheng et al., 2016; Moore et al., 2017). The reduced Ni(I) form of F430 is essential for catalysis (Goubeaud et al., 1997), but is highly sensitive to oxidative inactivation, a feature that renders biochemical characterization of MCR especially challenging. As a result, many attributes of this important enzyme remain uncharacterized.
An unusual feature of MCR is the presence of several modified amino acids within the active site of the α-subunit. Among these are a group of methylated amino acids, including 3-methylhistidine (or N1-methylhistidine), S-methylcysteine, 5(S)-methylarginine, and 2(S)-methylglutamine, which are presumed to be installed post-translationally by S-adenosylmethionine-dependent methyltransferases (Selmer et al., 2000; Kahnt et al., 2007). 3-methylhistidine is found in all MCRs examined to date, whereas the presence of the other methylated amino acids is variable among methane-metabolizing archaea (Kahnt et al., 2007). A didehydroaspartate modification is also observed in some, but not all, methanogens (Wagner et al., 2016). Lastly, a highly unusual thioglycine modification, in which the peptide amide bond is converted to a thioamide, is present in all methanogens that have been analyzed to date (Figure 1—figure supplement 1) (Ermler et al., 1997; Kahnt et al., 2007).
The function(s) of the modified amino acids in MCR has/have not yet been experimentally addressed; however, several theories have been postulated. The 3-methylhistidine may serve to position the imidazole ring that coordinates CoB. This methylation also alters the pKa of histidine in a manner that would promote tighter CoB-binding (Grabarse et al., 2000). The variable occurrence of the other methylated amino acids suggests that they are unlikely to be directly involved in catalysis. Rather, it has been hypothesized that they tune enzyme activity by altering the hydrophobicity and flexibility of the active site pocket (Kahnt et al., 2007; Grabarse et al., 2000). A similar argument has been made for the didehydroaspartate residue (Wagner et al., 2016). In contrast, three distinct mechanistic hypotheses have implicated the thioglycine residue in catalysis. One proposal is that the thioglycine facilitates deprotonation of CoB by reducing the pKa of the sulfhydryl group (Grabarse et al., 2001). A second proposal suggests that thioglycine could serve as an intermediate electron carrier for oxidation of a proposed heterodisulfide anion radical intermediate (Horng et al., 2001). Lastly, cis-trans isomerization of the thioamide during catalysis could potentially play an important role in coupling the two active sites via a previously proposed two-stroke mechanism for the enzyme (Goenrich et al., 2005).
Thioamides are rare in biology. While cycasthioamide is plant-derived (Pan et al., 1997), most other naturally occurring thioamides are of bacterial origin. Among these are the ribosomally synthesized and post-translationally modified (RiPP) peptide natural products thioviridamide (Hayakawa et al., 2006) and methanobactin (Kim et al., 2004; Kenney and Rosenzweig, 2012; Kenney and Rosenzweig, 2013), as well as closthioamide, which appears to be an unusual non-ribosomal peptide (Lincke et al., 2010; Chiriac et al., 2015). The nucleotide derivatives thiouridine and thioguanine (Coyne et al., 2014), and two additional natural product antibiotics, thiopeptin and Sch 18640 (Puar et al., 1981; Hensens and Albers-Schönberg, 1983), also contain thioamide moieties. Although the mechanism of thioamide installation in peptides has yet to be established, the identification of the thioviridamide biosynthetic gene cluster provides clues to their origin (Izawa et al., 2013). Two of the proteins encoded by this gene cluster have plausible roles in thioamide synthesis. The first, TvaH, is a member of the YcaO superfamily, while the second, TvaI, is annotated as a ‘TfuA-like’ protein (Izawa et al., 2013). Biochemical analyses of YcaO-family proteins indicate that they catalyze the ATP-dependent cyclodehydration of Cys, Ser, and Thr residues to the corresponding thiazoline, oxazoline, and methyloxazoline (Figure 1). Many ‘azoline’ heterocycles undergo dehydrogenation to the corresponding azole, which are prominent moieties in various RiPP natural products classes, such as linear azol(in)e-containing peptides, thiopeptides, and cyanobactins (Dunbar et al., 2012; Dunbar et al., 2014; Arnison et al., 2013; Burkhart et al., 2017). The YcaO-dependent synthesis of peptidic azol(in)e heterocycles often requires a partner protein, which typically is the neighboring gene in the biosynthetic gene cluster (Burkhart et al., 2015; Dunbar et al., 2015; Wright et al., 2006). Based on enzymatic similarity, the TfuA protein encoded adjacent to the YcaO in the thioviridamide pathway may also enhance the thioamidation reaction, perhaps by recruiting a sulfurtransferase protein. Although not RiPPs, thiouridine and thioguanine biosynthesis requires the use of sulfurtransferases (Coyne et al., 2013; Palenchar et al., 2000).
The biosynthesis of the thioglycine in MCR was proposed to occur by a mechanism similar to that used to produce thioamide-containing natural products (Kahnt et al., 2007), a prediction made six years prior to the discovery of the thioviridamide biosynthetic gene cluster (Izawa et al., 2013). Given their putative role in thioamidation reactions, it is notable that YcaO homologs were found to be universally present in an early analysis of methanogen genomes, resulting in their designation as ‘methanogenesis marker protein 1’ (Basu et al., 2011). Genes encoding TfuA homologs are also ubiquitous in methanogens, usually encoded in the same locus as ycaO, similar to their arrangement in the thioviridamide biosynthetic gene cluster. Therefore, both biochemical and bioinformatic evidence are consistent with these genes being involved in thioglycine formation. In this report, we use the genetically tractable methanogen Methanosarcina acetivorans to show that installation of the thioamide bond at Gly465 in the α-subunit of MCR requires the ycaO-tfuA locus (Figure 1—figure supplement 1). As MCR is essential for growth and survival (Rother et al., 2005), the viability of ycaO-tfuA mutants precludes the hypothesis that the thioamide residue is essential for MCR activity. Instead, our phenotypic analyses support a role for thioglycine in maintaining a proper structural conformation of residues near the active site, such that absence of this modification in MCR might be particularly detrimental on growth substrates that have low free energy yields as well as under additionally destabilizing conditions such as elevated temperatures.
Results
Phylogenetic analyses of TfuA and YcaO in methanogenic and methanotrophic archaea
To examine the possibility that YcaO and TfuA are involved in McrA thioamidation, we reassessed the distribution, diversity, and phylogeny of genes encoding these proteins in sequenced microbial genomes, which today comprise a much larger dataset than when ‘methanogenesis marker protein 1’ was first proposed (Basu et al., 2011). Significantly, all complete methanogen and ANME genome sequences encode a YcaO homolog, with a few strains encoding two copies (Figure 2). The YcaO sequences form a distinct, well-supported clade that also includes homologs from ammonia-oxidizing archaea (Figure 2—figure supplement 1). Excluding the second YcaO in strains that encode two copies, the YcaO tree is congruent with the phylogeny of methanogens reconstructed using housekeeping or mcr genes (Figure 2). Thus, it is likely that YcaO was acquired early in the evolution of methanogens and maintained largely through vertical inheritance, as expected for a trait that coevolved with MCR (Borrel et al., 2013; Vanwonterghem et al., 2016).
TfuA homologs are encoded in the overwhelming majority of MCR-encoding taxa, although a few species lack this gene. The latter include Methanopyrus kandleri and Methanocaldococcus janaschii, two species previously shown to contain the thioglycine modification (Kahnt et al., 2007) (Figure 2). Thus, TfuA cannot be obligatorily required for thioglycine installation. The archaeal TfuA proteins also fall within a single clade that is largely congruent with the evolutionary history of archaea (Figure 2—figure supplements 1–2); however, unlike YcaO, the methanogen-containing clade includes numerous bacterial homologs (Figure 2—figure supplement 2).
The genomic context of tfuA and ycaO in methanogens supports a shared or related function, perhaps involving sulfur incorporation and/or methanogenesis (Figure 2). When both are present, the two genes comprise a single locus in which the stop codon of the upstream ycaO gene overlaps with the start codon of the downstream tfuA gene, suggesting that they are co-transcribed. In several instances, additional genes involved in sulfur metabolism such as thiF, sufS, as well as moaD, moaE and moeB (involved in molybdopterin biosynthesis) (Zhang et al., 2010; Park et al., 2003), are found in the genomic vicinity. Occasionally, genes encoding enzymes involved in methanogenesis, including the Methanomassiliicoccus MCR operon, are locally encoded (Figure 2).
TfuA and YcaO are not essential in Methanosarcina acetivorans
To test their role in thioglycine installation, we generated a mutant lacking the ycaO-tfuA locus in the genetically tractable methanogen Methanosarcina acetivorans. Based on the hypothesis that thioglycine may be imperative for MCR activity, and the knowledge that the MCR-encoding operon (mcrBCDAG) is essential (Guss et al., 2008), we first examined the viability of ΔycaO-tfuA mutants using a recently developed Cas9-based assay for gene essentiality (Nayak and Metcalf, 2017). This assay compares the number of transformants obtained using a Cas9 gene-editing plasmid with and without a repair template that creates a gene deletion. Essential genes give similar, low numbers of transformants with or without the repair template; whereas non-essential genes give ca. 103-fold higher numbers with the repair template. Our data demonstrate that deletion of the ycaO-tfuA locus has no impact on viability (Figure 3). Several independent mutants were clonally purified and verified by PCR prior to phenotypic characterization (Figure 3—figure supplement 1).
The ∆ycaO-tfuA mutant lacks the McrA Gly465 thioamide
To test whether YcaO and TfuA are involved in the post-translational modification of Gly465 in McrA, we isolated the McrA protein from cell extracts of the isogenic parent (hereafter referred to as wild-type or WT), the ∆ycaO-tfuA mutant, as well as from ∆tfuA and ∆ycaO individual mutants (Figure 3—figure supplement 2). After performing SDS-PAGE, the appropriate Coomassie-stained bands were excised and then subjected to in-gel trypsin digestion. The resulting peptides were then analyzed by matrix-assisted laser desorption-ionization time-of-flight mass spectrometry (MALDI-TOF-MS). The mass spectrum from the WT strain showed a peak at m/z 3432 Da (Figure 4) corresponding to the peptide (461LGFFGFDLQDQCGATNVLSYQGDEGLPDELR491) with Gly465 being thioamidated (Kahnt et al., 2007; Grabarse et al., 2000). The identity of this peptide was confirmed by high-resolution electrospray ionization tandem MS analysis (HR-ESI-MS/MS, [M + 3H]3+ expt. m/z 1144.8608 Da; calc. m/z 1144.8546 Da; 5.4 ppm error; Figure 4—figure supplement 1A). This peptide also contains the recently reported didehydroaspartate modification at Asp470 (Wagner et al., 2016) and S-methylation at Cys472 (Selmer et al., 2000). Consistent with the involvement of TfuA-associated YcaO proteins in thioamide formation, we noted the absence of the m/z 3432 Da species in the mass spectrum of similarly treated ∆ycaO-tfuA, ∆tfuA, and ∆ycaO samples. Instead, a predominant m/z 3416 Da species appeared, which was 16 Da lighter, consistent with replacement of sulfur by oxygen (Figure 4). HR-ESI-MS/MS analysis of the corresponding peptide from the ∆ycaO-tfuA mutant confirmed the identity of this peptide as being McrA Leu461-Arg491 ([M + 3H]3+ expt. m/z 1139.5316 Da; calc. m/z 1139.5290 Da; 2.3 ppm error; Figure 4—figure supplement 1B). During HR-ESI-MS/MS analysis of the WT, thioamide-containing peptide, we did not observe fragmentation between Gly465 and Phe466. In contrast, fragmentation was seen at this location in the ∆ycaO-tfuA strain (b5 ion, Figure 4—figure supplement 1B). The lack of fragmentation in the WT peptide was anticipated based on the greater double bond character of C-N bonds in thioamides (Wiberg and Rablen, 1995).
To confirm that mutations in ycaO and/or tfuA were responsible for loss of the thioglycine modification, we transformed the ∆ycaO-tfuA mutant with a self-replicating plasmid containing the ycaO-tfuA locus fused to the tetracycline-inducible promoter PmcrB(tetO4) (Guss et al., 2008). Upon tryptic digestion of MCR from cultures supplemented with tetracycline, a peak at m/z 3432 Da reappeared (Figure 4). Similar results were obtained when complementation experiments were performed with the ycaO or tfuA genes in the corresponding single mutants (Figure 4).
The m/z 3375 Da species present in all samples corresponds to an unrelated tryptic peptide, McrA Asp392-Arg421 (Figure 4—figure supplement 2). We also observed a peak at m/z 1496 in the WT and mutant samples corresponding to a N-methylhistidine-containing tryptic peptide (His271-Arg284, Figure 4—figure supplement 3A). Thus, thioglycine formation is not a prerequisite for this modification. Additionally, a peak at m/z 1561 was observed, corresponding to McrA Phe408-Arg421, shows that Gln420 remains unmodified in M. acetivorans, as previously been observed for Methanosarcina barkeri (Figure 4—figure supplement 3B) (Kahnt et al., 2007).
Growth defects associated with loss of the McrA thioglycine modification
To understand potential phenotypic consequences of losing the thioglycine modification, we quantified the doubling time and growth yield by monitoring changes in optical density during growth of M. acetivorans on a variety of substrates (Table 1). While no significant differences were observed during growth on methanol or trimethylamine (TMA) at 36°C, the ∆ycaO-tfuA mutant had substantially longer generation times and lower cell yields on both dimethylsulfide (DMS) and acetate (Table 1). Interestingly, the growth phenotype on methanol medium was strongly temperature-dependent, with no observed differences at 29°C and 36°C, but severe defects observed for the ∆ycaO-tfuA mutant at 39°C and 42°C. Furthermore, unlike WT, the mutant was incapable of growth at 45°C (Figure 5).
Thioglycine does not influence the global stability of MCR
Given that the C-N bond rotation barrier is higher for thioamides relative to amide (Wiberg and Rablen, 1995), we tested if the presence of thioglycine promotes the thermal stability of MCR. We evaluated thermal stability by assaying the melting temperature of MCR purified from WT and the ∆ycaO-tfuA mutant. A tandem affinity purification (TAP) tag consisting of a 3 × FLAG tag and a Twin-Strep tag was introduced immediately upstream of the start codon of mcrG (Figure 5—figure supplement 1A). The proteins were affinity-purified using a Strep-tactin resin under aerobic conditions (Figure 5—figure supplement 1B). Using the SYPRO Orange-based Thermofluor assay (Huynh and Partch, 2015), the melting temperature of WT MCR was 67.3 ± 0.3°C (mean ± 95% confidence interval of three technical replicates) whereas the melting temperature for the MCR variant lacking thioglycine was 69.1 ± 0.2°C. Additionally, quantification of the protein and F430 concentrations by Bradford assay and absorption at 280/430 nm demonstrated that the F430 content was not significantly affected by the presence of thioglycine (Figure 5—figure supplement 2).
Discussion
The loss of the thioglycine modification in the ∆ycaO, ∆tfuA, and ΔycaO-tfuA mutants shows that both of these genes are required for the thioamidation of McrA. Although this could be an indirect requirement, we believe it is more likely that the YcaO/TfuA proteins directly catalyze modification of McrA. This conclusion is mechanistically compatible with biochemical analyses of YcaO homologs. YcaO enzymes that carry out the ATP-dependent cyclodehydration of beta-nucleophile-containing amino acids have been extensively investigated (Burkhart et al., 2017). Such cyclodehydratases coordinate the nucleophilic attack of the Cys, Ser, and Thr side chain on the preceding amide carbonyl carbon in a fashion reminiscent of intein splicing (Perler et al., 1997) (Figure 1). The enzyme then O-phosphorylates the resulting oxyanion and subsequently N-deprotonates the hemiorthoamide, yielding an azoline heterocycle. An analogous reaction can be drawn for the YcaO-dependent formation of peptidic thioamides. The only difference is that an exogenous equivalent of sulfide is required for the thioamidation reaction, rather than an adjacent beta-nucleophile-containing amino acid for azoline formation (Figure 1).
Most YcaO cyclodehydratases require a partner protein for catalytic activity. The earliest investigated YcaO partner proteins are homologs of the ThiF/MoeB family, which are related to E1 ubiquitin-activating enzymes (Dunbar et al., 2014; Schulman et al., 2009). These YcaO partner proteins, as well as the more recently characterized ‘ocin-ThiF’ variety (Dunbar et al., 2015), contain a ~ 90 residue domain referred to as the RiPP precursor peptide Recognition Element (RRE), which facilitates substrate recognition by interacting with the leader peptide. Considering these traits of azoline-forming YcaOs, it is possible that thioamide-forming YcaOs require the TfuA partner to facilitate binding to the peptidic substrate. Alternatively, TfuA may recruit and deliver sulfide equivalents by a direct or indirect mechanism. In this regard, it is noteworthy that the ycaO-tfuA locus can be found adjacent to genes involved in sulfur and molybdoterin metabolism (Figure 2). Many of these genes encode proteins with rhodanese-like homology domains, which are well-established sulfurtransferases. These enzymes typically carry sulfur in the form of a cysteine persulfide, a non-toxic but reactive equivalent of H2S (Palenchar et al., 2000; Matthies et al., 2005). Akin to rare cases of azoline-forming, partner-independent YcaOs, certain methanogens lack a bioinformatically identifiable TfuA (e.g. Methanopyrus kandleri and Methanocaldococcus sp., Figure 2). Whether these YcaOs act independently or use an as yet-unidentified partner protein remains to be seen. Clearly, further in vitro experimentation will be required to delineate the precise role of TfuA in the thioamidation reaction.
The viability of the ΔycaO-tfuA mutant raises significant questions as to the role of thioglycine in the native MCR enzyme, especially considering its universal presence in all MCRs examined to date. We considered three hypotheses to explain this result. First, we examined the possibility that thioglycine modification is involved in enhancing the reaction rate (Kahnt et al., 2007; Horng et al., 2001). Although it has not been explicitly determined, MCR is thought to catalyze the rate-limiting step of methanogenesis (Scheller et al., 2010; Wongnate et al., 2016). Therefore, the absence of thioglycine might lead to a corresponding decrease in the growth rate, with more pronounced defects on substrates that lead to the fastest growth. However, we observed the opposite: the most pronounced defects were observed with growth substrates that support the slowest WT growth rates (Table 1). Next, we considered the possibility that the thioglycine influences substrate affinity. C1 units enter methanogenesis at the level of N5-methyl-tetrahydrosarcinapterin (CH3-H4SPt) during growth on acetate (Galagan et al., 2002; Deppenmeier et al., 1999), but at the level of methyl-CoM during growth on DMS, methanol, and TMA (Figure 6) (Bose et al., 2008; Fu and Metcalf, 2015). Significantly, these entry points are separated by an energy-dependent step that is coupled to production or consumption of the trans-membrane Na+ gradient. As a result, intracellular levels of methyl-CoM, CoM, and CoB could possibly be significantly different depending on the entry point into the methanogenic pathway. Because we observed growth defects on substrates that enter at both points (i.e. DMS and acetate), we suspect that the growth deficiency phenotype is unlikely to be related to changes in substrate affinity. A third explanation we considered was that thioglycine increases the stability of MCR. In this model, unstable MCR protein would need to be replaced more often, creating a significant metabolic burden for the mutant. Consistent with our results, this additional burden would be exacerbated on lower energy substrates like DMS and acetate, especially given that MCR comprises ~10% of the total protein (Rospert et al., 1990). Further, one would expect that a protein stability phenotype would be exaggerated at higher temperatures, which we observed during growth on methanol (Figure 5). Thus, multiple lines of evidence support the idea that the growth-associated phenotypes stemming from the deletion of TfuA and YcaO are caused by decreased MCR stability. However, the melting temperature of MCR from the ∆ycao-tfuA mutant was modestly higher than that purified from the WT. As the thioglycine is buried deep within the active site of MCR (Ermler et al., 1997), these data are consistent with the notion that thioamidation does not affect the global stability of the protein. Instead, it suggests that the thioglycine modification impacts the local stability in the vicinity of the buried active site of MCR (Figure 1—figure supplement 1), which in turn might have a detrimental effect under catalytic turnover conditions.
The chemical properties of amides relative to thioamides are consistent with our hypothesis. Although amides tend to be planar, their rotational barriers are lower than for the corresponding thioamide and thus they are more conformationally flexible. This is especially true for glycine. Considering the negligible electronegativity difference between sulfur and carbon, the thioamide carbonyl is not polarized like an amide carbonyl (Wiberg and Rablen, 1995). Further, sulfur has a larger van der Waals radius than oxygen resulting in a thioamide bond length that is ~40% longer than the amide bond (1.71 Å versus 1.23 Å) (Petersson et al., 2014), which presents additional steric hindrances to backbone flexibility. Finally, the pKa of thioamides is lower than amides, making thioglycine a stronger hydrogen bond donor than glycine (Lee et al., 2002), which again could reduce conformational flexibility. Taken together, it is chemically reasonable to state that the increased flexibility of the unmodified glycine in the ΔycaO-tfuA mutant would render the contorted conformation of the peptide backbone in the Gly462-Leu469 region of McrA considerably less stable (Figure 1—figure supplement 1). Indeed, this region adopts a rather strange configuration, with the side chain of Phe463 bending back towards the thioamide of Gly465. The molecular alignment and distance (3.5 Å) suggests a potential π-cation interaction between these residues(Figure 1—figure supplement 1) The thioamide sulfur is also optimally distanced (3.6 Å) and geometrically positioned to form an H-bond with the side chain of Asn501 and the backbone N-H of Leu469. There also appears to be a hydrophobic interaction between the thioamide and the beta carbon of Leu469, which would be energetically unfavorable with a more polarized amide. These observations suggest that the local stability in the vicinity of the active site imparted by the thioamide is required for protein stability and increased half-life of the MCR protein. A conclusive test of this hypothesis will require comprehensive structural and biochemical characterization of the active MCR variant lacking the thioglycine modification, which is beyond the scope of this work.
Finally, the temperature-sensitive phenotype of the ΔycaO-tfuA mutant has potential implications regarding the evolution and ecology of methanogenic archaea. Based on this result, it seems reasonable to speculate that the thioglycine modification would be indispensable for thermophilic methanogens. It is often posited that the ancestor of modern methanogens was a thermophilic organism (Gribaldo and Brochier-Armanet, 2006; Forterre, 2015; Weiss et al., 2016; López-García et al., 2015). If so, one would expect the thioglycine modification to be present in most methanogenic lineages, being stochastically lost due to genetic drift only in lineages that grow at low temperatures where the modification is not required. In contrast, if methanogenesis evolved in a cooler environment, one might expect the distribution of the modification to be restricted to thermophilic lineages. Thus, the universal presence of the thioglycine modification supports the thermophilic ancestry of methanogenesis. Indeed, the ycaO-tfuA locus is conserved even in Methanococcoides burtonii, a psychrophilic methanogen isolated from Ace Lake in Antarctica, where the ambient temperature is always below 2°C (Franzmann et al., 1992). It will be interesting to see whether this modification is maintained by other methanogenic and methanotrophic archaea growing in low temperature environments.
Materials and methods
Bioinformatics analyses
Request a detailed protocolThe 1000 closest homologs were extracted from the NCBI non-redundant protein database using the YcaO amino acid sequence (MA0165) or the TfuA amino acid sequence (MA0164) as queries in BLAST-P searches. The amino acid sequences of these proteins were aligned using the MUSCLE plug-in (Edgar, 2004) with default parameters in Geneious version R9 (Kearse et al., 2012). Approximate maximum-likelihood trees were generated using FastTree version 2.1.3 SSE3 using the Jones-Taylor-Thornton (JTT) model +CAT approximation with 20 rate categories. Branch support was calculated using the Shimodaira-Hasegawa (SH) test with 1000 resamples. Trees were displayed using Fig Tree v1.4.3 (http://tree.bio.ed.ac.uk/software/figtree/).
Strains, media, and growth conditions
Request a detailed protocolAll M. acetivorans strains were grown in single-cell morphology (Sowers et al., 1993) in bicarbonate-buffered high salt (HS) liquid medium containing 125 mM methanol, 50 mM trimethylamine hydrochloride (TMA), 40 mM sodium acetate, or 20 mM dimethylsulfide (DMS). Cultures were grown in sealed tubes with N2/CO2 (80/20) at 8–10 psi in the headspace. Most substrates were added to the medium prior to autoclaving. DMS was added from an anaerobic stock solution maintained at 4°C immediately prior to inoculation. Growth rate measurements were conducted with three independent biological replicate cultures acclimated to the energy substrate or temperature as indicated. A 1:10 dilution of a late-exponential phase culture was used as the inoculum for growth rate measurement. Plating on HS medium containing 50 mM TMA solidified with 1.7% agar was conducted in an anaerobic glove chamber (Coy Laboratory Products, Grass Lake, MI) as described previously (Metcalf et al., 1996). Solid media plates were incubated in an intra-chamber anaerobic incubator maintained at 37°C with N2/CO2/H2S (79.9/20/0.1) in the headspace as described previously (Metcalf et al., 1998). Puromycin (CalBiochem, San Diego, CA) was added to a final concentration of 2 μg/mL from a sterile, anaerobic stock solution to select for transformants containing the pac (puromycin transacetylase) cassette. The purine analog 8-aza-2,6-diaminopurine (8ADP) (R. I. Chemicals, San Diego, CA) was added to a final concentration of 20 µg/mL from a sterile, anaerobic stock solution to select against the hpt (phosphoribosyltransferase) cassette encoded on pC2A-based plasmids. Anaerobic, sterile stocks of tetracycline hydrochloride in deionized water were prepared fresh shortly before use and added to a final concentration of 100 µg/mL to the growth medium of strains containing ycaO and/or tfuA fused to PmcrB(tetO4). E. coli strains were grown in LB broth at 37°C with standard antibiotic concentrations. WM4489, a DH10B derivative engineered to control copy-number of oriV-based plasmids (Kim et al., 2012), was used as the host strain for all plasmids generated in this study (Supplementary file 1). Plasmid copy number was increased dramatically by supplementing the growth medium with sterile rhamnose to a final concentration of 10 mM.
Plasmids
All plasmids used in this study are listed in Supplementary file 1. Plasmids for Cas9-mediated genome editing were designed as described previously (Nayak and Metcalf, 2017). For designing the complementation plasmids, the ycaO and/or tfuA coding sequence(s) were amplified and fused to the PmcrB(tetO4) promoter in pJK029A (Guss et al., 2008) linearized with NdeI and HindIII by the Gibson assembly method as described previously in Nayak and Metcalf, 2017. Standard techniques were used for the isolation and manipulation of plasmid DNA. WM4489 was transformed by electroporation at 1.8 kV using an E. coli Gene Pulser (Bio-Rad, Hercules, CA). All pDN201-derived plasmids were verified by Sanger sequencing at the Roy J. Carver Biotechnology Center, University of Illinois at Urbana-Champaign and all pAMG40 cointegrates were verified by restriction endonuclease analysis.
In silico design of sgRNAs for gene-editing
Request a detailed protocolAll target sequences used for Cas9-mediated genome editing in this study are listed in Supplementary file 2. Target sequences were chosen using the CRISPR site finder tool in Geneious version R9 (61). The M. acetivorans chromosome and the plasmid pC2A were used to score off-target binding sites.
Transformation of M. acetivorans
Request a detailed protocolAll M. acetivorans strains used in this study are listed in Supplementary file 3. Liposome-mediated transformation was used for M. acetivorans as described previously (Metcalf et al., 1997) using 10 mL of late-exponential phase culture of M. acetivorans and 2 µg of plasmid DNA for each transformation.
In-gel tryptic digest of McrA
Request a detailed protocolMid-exponential phase cultures of M. acetivorans grown in 10 mL HS medium containing 50 mM TMA were harvested by centrifugation (3000 × g) for 15 min at 4°C (DuPont, Wilmington, DE). The cell pellet was resuspended in 1 mL lysis buffer (50 mM NH4HCO3, pH = 8.0) and harvested by centrifugation (17,500 × g) for 30 min at 4°C (DuPont, Wilmington, DE). An equal volume of the supernatant was mixed with 2 × Laemmli sample buffer (Bio-Rad, Hercules, CA) containing 5% β-mercaptoethanol, incubated in boiling water for 10 min, loaded on a 4–20% gradient Mini-Protean TGX denaturing SDS-PAGE gel (Bio-Rad, Hercules, CA) and run at 70 V until the dye-front reached the bottom of the gel. The gel was stained using the Gel Code Blue stain reagent (Thermo Fisher Scientific, Waltham, MA) as per the manufacturer’s instructions. Bands corresponding to McrA (ca. 60 kDa) were excised and cut into ca. 1 × 1 mm cubes. The gel slices from a single lane were destained with 50% acetonitrile, the corresponding protein was reduced with 10 mM dithiothreitol (DTT), and digested with 1.5 µg sequencing-grade trypsin (Promega, Madison, WI) at 37°C for 16–20 hr in the presence of 5% (v/v) n-propanol. The digested peptides were extracted and dried as described previously (Shevchenko et al., 2006).
MS analysis of tryptic peptides
Request a detailed protocolMALDI-TOF-MS analysis was performed using a Bruker UltrafleXtreme MALDI TOF-TOF mass spectrometer (Bruker Daltonics, Billerica, MA) in reflector positive mode at the University of Illinois School of Chemical Sciences Mass Spectrometry Laboratory. The samples were desalted using C-18 zip-tips using aqueous acetonitrile and sinapic acid in 70% acetonitrile as the matrix. Data analysis was carried out using the Bruker FlexAnalysis software. For HR-ESI MS/MS, samples were dissolved in 35% aq. acetonitrile and 0.1% formic acid. Samples were directly infused using an Advion TriVersa Nanomate 100 into a ThermoFisher Scientific Orbitrap Fusion ESI-MS. The instrument was calibrated weekly, following the manufacturer’s instructions, and tuned daily with Pierce LTQ Velos ESI Positive Ion Calibration Solution (Thermo Fisher Scientific, Waltham, MA). The MS was operated using the following parameters: resolution, 100,000; isolation width (MS/MS), 1 m/z; normalized collision energy (MS/MS), 35; activation q value (MS/MS), 0.4; activation time (MS/MS), 30 ms. Data analysis was conducted using the Qualbrowser application of Xcalibur software (Thermo Fisher Scientific, Waltham, MA). HPLC-grade reagents were used to prepare samples for mass spectrometric analyses.
MCR purification
Request a detailed protocolMCR was purified from 250 mL of mid-exponential phase culture grown in HS +50 mM TMA at 36°C. Protein purification was performed under aerobic conditions and cells were harvested by centrifugation (3000 × g) for 15 min at 4°C. The cell pellet was lysed in 5 mL of Wash buffer (50 mM NaH2PO4, 300 mM NaCl, pH = 8.0) and the cell lysate was clarified by centrifugation (17,500 × g) for 30 min at 4°C. The supernatant fraction was loaded on a column containing 2 mL Strep-tactin XT Superflow resin (50% suspension; IBA Lifesciences, Goettingen, Germany) equilibrated with 4 mL of the Wash buffer. The column was washed twice with 4 mL of Wash buffer and the purified protein was eluted in four fractions with 0.5 mL Elution buffer (50 mM NaH2PO4, 300 mM NaCl, 50 mM biotin, pH = 8.0) per fraction. The protein concentration in each fraction was estimated using the Coomassie Plus (Bradford) assay kit (Pierce Biotechnology, Thermo-Scientific, Rockford, IL, USA) with BSA (bovine serum albumin) as the standard per the manufacturer’s instructions. The highest protein concentration (ca. 600 μg/mL) was obtained in fraction 3 therefore this fraction was used to conduct the Thermofluor assay. To visualize the purified protein, 10 µL of the crude cell extract as well as fraction 3 were mixed with an equal volume of 2 × Laemmli sample buffer (Bio-Rad, Hercules, CA) containing 5% β-mercaptoethanol, incubated in boiling water for 10 min, loaded on a 4–20% gradient Mini-Protean TGX denaturing SDS-PAGE gel (Bio-Rad, Hercules, CA) and run at 70 V until the dye-front reached the bottom of the gel. The gel was stained using the Gel Code Blue stain reagent (Thermo Fisher Scientific, Waltham, MA) as per the manufacturer’s instructions. All three bands corresponding to the MCR subunits were observed and verified by LC-MS analyses of the tryptic peptides from fraction 3 of the purified protein sample at the Protein Sciences facility at the Roy J. Carver Biotechnology Center at the University of Illinois, Urbana-Champaign, USA. A fourth band, identified as a hypothetical protein encoded by MA3997, was also detected in each sample (Figure 5—figure supplement 1).
Thermofluor assay
Request a detailed protocolA 5000 × concentrate of SYPRO Orange protein gel stain in DMSO (Thermo-Fisher Scientific, Waltham, MA, USA) was diluted with the Elution buffer to generate a 200 × stock solution. 5 µL of the 200 × stock solution of SYPRO Orange protein gel stain was added to 45 µL of purified protein with a concentration of ca. 600 µg/mL in 96-well optically clear PCR plates. A melt curve was performed on a Mastercycler ep realplex machine (Eppendorf, Hamburg, Germany) using the following protocol: 25°C for 30 s, ramp to 99°C over 30 min, return to 25°C for 30 s. SYPRO Orange fluorescence was detected using the VIC emission channel and the temperature corresponding to the inflection point of the first derivative (dI/dT) was determined to be the melting temperature (Tm). Appropriate no-dye controls and no-protein controls were examined and each sample was run in triplicate. The Thermofluor assay was conducted within 12 hr of protein purification.
UV-Vis spectrum of MCR
Request a detailed protocolThe spectrum was obtained on a Cary 4000 UV-Vis spectrophotometer (Varian, Palo Alto, CA, USA) using 200 µL of protein sample (1.5 µM each) in a quartz supracil cuvette (Hellma Analytics, Mullheim, Germany). The scanning range was 200–800 nm and the Elution buffer was used as a blank.
References
-
A prevalent peptide-binding domain guides ribosomal natural product biosynthesisNature Chemical Biology 11:564–570.https://doi.org/10.1038/nchembio.1856
-
Mode of action of closthioamide: the first member of the polythioamide class of bacterial DNA gyrase inhibitorsJournal of Antimicrobial Chemotherapy 70:2576–2588.https://doi.org/10.1093/jac/dkv161
-
Biosynthesis of the antimetabolite 6-thioguanine in Erwinia amylovora plays a key role in fire blight pathogenesisAngewandte Chemie International Edition 52:10564–10568.https://doi.org/10.1002/anie.201305595
-
YcaO domains use ATP to activate amide backbones during peptide cyclodehydrationsNature Chemical Biology 8:569–575.https://doi.org/10.1038/nchembio.944
-
Discovery of a new ATP-binding motif involved in peptidic azoline biosynthesisNature Chemical Biology 10:823–829.https://doi.org/10.1038/nchembio.1608
-
Identification of an Auxiliary Leader Peptide-Binding Protein Required for Azoline Formation in Ribosomal Natural ProductsJournal of the American Chemical Society 137:7672–7677.https://doi.org/10.1021/jacs.5b04682
-
MUSCLE: multiple sequence alignment with high accuracy and high throughputNucleic Acids Research 32:1792–1797.https://doi.org/10.1093/nar/gkh340
-
The universal tree of life: an updateFrontiers in Microbiology 6:1–18.https://doi.org/10.3389/fmicb.2015.00717
-
A Methanogenic Archaeon from Ace Lake, Antarctica: Methanococcoides burtonii sp. novSystematic and Applied Microbiology 15:573–581.https://doi.org/10.1016/S0723-2020(11)80117-7
-
Genetic basis for metabolism of methylated sulfur compounds in Methanosarcina speciesJournal of Bacteriology 197:1515–1524.https://doi.org/10.1128/JB.02605-14
-
Temperature dependence of methyl-coenzyme M reductase activity and of the formation of the methyl-coenzyme M reductase red2 state induced by coenzyme BJBIC Journal of Biological Inorganic Chemistry 10:333–342.https://doi.org/10.1007/s00775-005-0636-6
-
The origin and evolution of Archaea: a state of the artPhilosophical Transactions of the Royal Society B: Biological Sciences 361:1007–1022.https://doi.org/10.1098/rstb.2006.1841
-
Structure of thioviridamide, a novel apoptosis inducer from Streptomyces olivoviridisThe Journal of Antibiotics 59:6–10.https://doi.org/10.1038/ja.2006.2
-
Total structure of the highly modified peptide antibiotic components of thiopeptinThe Journal of Antibiotics 36:814–831.https://doi.org/10.7164/antibiotics.36.814
-
Analysis of protein stability and ligand interactions by thermal shift assayCurrent Protocols in Protein Science 79:28.9.1–28.928.https://doi.org/10.1002/0471140864.ps2809s79
-
Cloning and heterologous expression of the thioviridamide biosynthesis gene cluster from Streptomyces olivoviridisApplied and Environmental Microbiology 79:7110–7113.https://doi.org/10.1128/AEM.01978-13
-
Chemistry and biology of the copper chelator methanobactinACS Chemical Biology 7:260–268.https://doi.org/10.1021/cb2003913
-
Different biosynthetic pathways to fosfomycin in Pseudomonas syringae and Streptomyces speciesAntimicrobial Agents and Chemotherapy 56:4175–4183.https://doi.org/10.1128/AAC.06478-11
-
Hydrogen bonding abilities of thioamideThe Journal of Physical Chemistry A 106:7010–7017.https://doi.org/10.1021/jp025516e
-
Bacterial gene import and mesophilic adaptation in archaeaNature Reviews Microbiology 13:447–456.https://doi.org/10.1038/nrmicro3485
-
An anaerobic, intrachamber incubator for growth of Methanosarcina spp. on methanol-containing solid mediaApplied and Environmental Microbiology 64:768–770.
-
Nonprotein amino acids from Cycas revolutaPhytochemistry 45:517–519.https://doi.org/10.1016/S0031-9422(96)00866-7
-
Biosynthesis of the thiazole moiety of thiamin pyrophosphate (vitamin B1)Biochemistry 42:12430–12438.https://doi.org/10.1021/bi034902z
-
Protein splicing and autoproteolysis mechanismsCurrent Opinion in Chemical Biology 1:292–299.https://doi.org/10.1016/S1367-5931(97)80065-8
-
On the use of thioamides as fluorescence quenching probes for tracking protein folding and stabilityPhys. Chem. Chem. Phys. 16:6827–6837.https://doi.org/10.1039/C3CP55525A
-
Sch 18640. A new thiostrepton-type antibioticJournal of the American Chemical Society 103:5231–5233.https://doi.org/10.1021/ja00407a047
-
Two genetically distinct methyl-coenzyme M reductases in Methanobacterium thermoautotrophicum strain Marburg and delta HEuropean Journal of Biochemistry 194:871–877.https://doi.org/10.1111/j.1432-1033.1990.tb19481.x
-
Methanol-dependent gene expression demonstrates that methyl-coenzyme M reductase is essential in Methanosarcina acetivorans C2A and allows isolation of mutants with defects in regulation of the methanol utilization pathwayJournal of Bacteriology 187:5552–5559.https://doi.org/10.1128/JB.187.16.5552-5559.2005
-
Ubiquitin-like protein activation by E1 enzymes: the apex for downstream signalling pathwaysNature Reviews Molecular Cell Biology 10:319–331.https://doi.org/10.1038/nrm2673
-
The biosynthesis of methylated amino acids in the active site region of methyl-coenzyme M reductaseJournal of Biological Chemistry 275:3755–3760.https://doi.org/10.1074/jbc.275.6.3755
-
Disaggregation of Methanosarcina spp. and Growth as Single Cells at Elevated OsmolarityApplied and Environmental Microbiology 59:3832–3839.
-
Methanogenic archaea: ecologically relevant differences in energy conservationNature Reviews Microbiology 6:579–591.https://doi.org/10.1038/nrmicro1931
-
Didehydroaspartate modification in methyl-coenzyme M reductase catalyzing methane formationAngewandte Chemie International Edition 55:10630–10633.https://doi.org/10.1002/anie.201603882
-
The physiology and habitat of the last universal common ancestorNature Microbiology 1:16116.https://doi.org/10.1038/nmicrobiol.2016.116
-
Why does thioformamide have a larger rotational barrier than formamide?Journal of the American Chemical Society 117:2201–2209.https://doi.org/10.1021/ja00113a009
-
Direct evidence for enzyme persulfide and disulfide intermediates during 4-thiouridine biosynthesisChemical Communications 29:3104–3106.https://doi.org/10.1039/b604040c
Article and author information
Author details
Funding
National Institute of General Medical Sciences (GM097142)
- Douglas A Mitchell
Life Sciences Research Foundation (Simons Foundation)
- Dipti D Nayak
U.S. Department of Energy (DE-FG02-02ER15296)
- William W Metcalf
The funders had no role in study design, data collection and interpretation, or the decision to submit the work for publication.
Acknowledgements
We thank Graham A Hudson (DAM lab) for technical assistance with the HR and tandem MS data acquisition and Dr. Peter Yau at the Protein Sciences facility at the Roy J Carver Biotechnology Center at the University of Illinois for identifying the protein that co-purified with MCR.
Version history
- Received: June 2, 2017
- Accepted: August 11, 2017
- Version of Record published: September 7, 2017 (version 1)
Copyright
© 2017, Nayak et al.
This article is distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use and redistribution provided that the original author and source are credited.
Metrics
-
- 3,324
- views
-
- 524
- downloads
-
- 81
- citations
Views, downloads and citations are aggregated across all versions of this paper published by eLife.
Download links
Downloads (link to download the article as PDF)
Open citations (links to open the citations from this article in various online reference manager services)
Cite this article (links to download the citations from this article in formats compatible with various reference manager tools)
Further reading
-
- Biochemistry and Chemical Biology
- Microbiology and Infectious Disease
Mycobacterium tuberculosis (Mtb) is known to survive within macrophages by compromising the integrity of the phagosomal compartment in which it resides. This activity primarily relies on the ESX-1 secretion system, predominantly involving the protein duo ESAT-6 and CFP-10. CFP-10 likely acts as a chaperone, while ESAT-6 likely disrupts phagosomal membrane stability via a largely unknown mechanism. we employ a series of biochemical analyses, protein modeling techniques, and a novel ESAT-6-specific nanobody to gain insight into the ESAT-6’s mode of action. First, we measure the binding kinetics of the tight 1:1 complex formed by ESAT-6 and CFP-10 at neutral pH. Subsequently, we demonstrate a rapid self-association of ESAT-6 into large complexes under acidic conditions, leading to the identification of a stable tetrameric ESAT-6 species. Using molecular dynamics simulations, we pinpoint the most probable interaction interface. Furthermore, we show that cytoplasmic expression of an anti-ESAT-6 nanobody blocks Mtb replication, thereby underlining the pivotal role of ESAT-6 in intracellular survival. Together, these data suggest that ESAT-6 acts by a pH-dependent mechanism to establish two-way communication between the cytoplasm and the Mtb-containing phagosome.
-
- Microbiology and Infectious Disease
Human H3N2 influenza viruses are subject to rapid antigenic evolution which translates into frequent updates of the composition of seasonal influenza vaccines. Despite these updates, the effectiveness of influenza vaccines against H3N2-associated disease is suboptimal. Seasonal influenza vaccines primarily induce hemagglutinin-specific antibody responses. However, antibodies directed against influenza neuraminidase (NA) also contribute to protection. Here, we analysed the antigenic diversity of a panel of N2 NAs derived from human H3N2 viruses that circulated between 2009 and 2017. The antigenic breadth of these NAs was determined based on the NA inhibition (NAI) of a broad panel of ferret and mouse immune sera that were raised by infection and recombinant N2 NA immunisation. This assessment allowed us to distinguish at least four antigenic groups in the N2 NAs derived from human H3N2 viruses that circulated between 2009 and 2017. Computational analysis further revealed that the amino acid residues in N2 NA that have a major impact on susceptibility to NAI by immune sera are in proximity of the catalytic site. Finally, a machine learning method was developed that allowed to accurately predict the impact of mutations that are present in our N2 NA panel on NAI. These findings have important implications for the renewed interest to develop improved influenza vaccines based on the inclusion of a protective NA antigen formulation.