A zinc-binding peptide was obtained from the albumin fraction of chickpea Cicer arietinum by separating Zn2+ using immobilizing metal-affinity chromatography followed by isolation using reversed-phase HPLC. GC-MS results showed that the molecular mass of the peptide was 3896 Da and that the peptide consisted of the 34 amino-acid residues IVQQPDGEKSERKIENENGEGEDGEQDLTVYDFE. This peptide was determined to be a fragment of a protein with a zinc finger.
Similar content being viewed by others
References
A. E. Al-Snafi, IOSR J. Pharm., 6 (3), 29 (2016).
A. Yili, Q. L. Ma, Q. Y. Lv, Y. H. Gao, B. Zhao, O. N. Veshkurova, Sh. I. Salikhov, and H. A. Aisa, Chem. Nat. Compd., 48, 643 (2012).
M. Yust, M. C. Millan-Linares, J. M. Alcaide-Hidalgo, F. Millan, and J. Pedroche, J. Sci. Food Agric., 92 (9), 1994 (2012).
S. Kumar, V. Kapoor, K. Gill, K. Singh, I. Xess, S. N. Das, and Sh. Dey, BioMed Res. Int., 2014, 387203 (2014).
A. Yili, M. Q. Ling, Zh. Bo, A. S. Asrorov, Yu. I. Oshchepkova, Sh. I. Salikhov, and H. A. Aisa, Chem. Nat. Compd., 47, 959 (2012).
D. Bhowmik, Chiranjib, and K. P. Sampath Kumar, Int. J. Pharm. Biomed. Sci., 1 (1), 5 (2010).
L. M. Plum, L. Rink, and H. Haase, Int. J. Environ. Res. Public Health, 7 (4), 1342 (2010).
C. Megias, J. Pedroche, M. Yust, J Giro-Calle, M. Alaiz, F. Millan, and J. Vioque, J. Agric. Food Chem., 55 (10), 3949 (2007).
L. M. Real Hernandez and E. G. Mejia, Compr. Rev. Food Sci. Food Saf., 18 (6), 1913 (2019).
W. Liao, T. Lai, L. Chen, J. Fu, S. T. Sreenivasan, Zh. Yu, and J. Ren, J. Agric. Food Chem., 64 (7), 1509 (2016).
Zh. Fang, L. Xu, Y. Lin, X. Cai, and Sh. Wang, Food Control, 98 (10), 24 (2019).
K. Zhu, X. Wang, and X. Guo, J. Funct. Foods, 12 (1), 23 (2015).
Ch. Wang, B. Li, and J. Ao, Food Chem., 134 (2), 1231 (2012).
O. L. Tavano and V. A. Neves, Food Sci. Technol., 41 (7), 1244 (2008).
N. Xie, J. Huang, B. Li, J. Cheng, Zh. Wang, J. Yin, and X. Yan, Food Chem., 173 (4), 210 (2014).
Ch. Wang, Ch. Wang, B. Li, and H. Li, Food Chem., 165 (12), 594 (2014).
Q. Wang and Y. L. Xiong, J. Funct. Foods, 49 (10), 105 (2018).
T. Fu, Sh. Zhang, Y. Shen, Y. Feng, Y. Jiang, Y. Zhang, M. Yu, and Ch. Wang, Eur. Food Res. Technol., 246 (11), 113 (2020).
M. Ch. Udechukwu, B. Downey, and Ch. C. Udenigwe, Food Chem., 240, 1227 (2018).
Z. Zhang, F. Zhou, X. Liu, and M. Zhao, Food Chem., 258, 269 (2018).
A. Waili, Y. H. Gao, L. F. Zhang, Zh. F. Ziyavitdinov, V. V. Maksimov, A. Yili, and H. A. Aisa, Chem. Nat. Compd., 54, 1135 (2018).
Acknowledgment
The work was financed by the Chinese Foundation for Science and Technology Support of Xinjiang-Uyghur Autonomous Region of China (Grant No. 2020E02105), by the Presidential Initiative for International Stipends of the Chinese Academy of Sciences (Grant No. 2021VBA0012), the Stipend Program of the President, CAS-TWAS, PIFI, CAS Foundation Project No. 2019VBA0013, and the Tian-Shan Pine Project for 2020: Candidate Pool of Leading Talent for Scientific and Technical Innovation.
Author information
Authors and Affiliations
Corresponding author
Additional information
Translated from Khimiya Prirodnykh Soedinenii, No. 1, January–February, 2022, pp. 78–81.
Rights and permissions
About this article
Cite this article
Mukhamedov, N., Mirzaakhmedov, S.Y., Gao, Y.H. et al. Zinc-Binding Peptides from Protein of Cicer arietinum. Chem Nat Compd 58, 86–89 (2022). https://doi.org/10.1007/s10600-022-03602-3
Received:
Published:
Issue Date:
DOI: https://doi.org/10.1007/s10600-022-03602-3